SciELO - Scientific Electronic Library Online

 
vol.69 issue1Interaction of weather variables with dengue and Aedes aegypti in the municipality of Camagüey author indexsubject indexarticles search
Home Pagealphabetic serial listing  

My SciELO

Services on Demand

Article

Indicators

  • Have no cited articlesCited by SciELO

Related links

  • Have no similar articlesSimilars in SciELO

Share


Revista Cubana de Medicina Tropical

On-line version ISSN 1561-3054

Rev Cubana Med Trop vol.69 no.1 Ciudad de la Habana Jan.-Apr. 2017

 

ARTÍCULO ORIGINAL

 

Actividad biológica complementaria in vitro del péptido antifúngico Cm-p5 y predicción in silico de sus regiones funcionales

 

In vitro complementary biological activity of the antifungal peptide Cm-p5 and in silico prediction of its functional regions

 

 

Melaine González García,I Mario E. Valdés,I Camila G. Freitas,II Annia Alba Menéndez,I,III Carlos López Abarrategui,I,IV Javier San Juan Galán,V Simoni Campos Diaz,II Octavio Luiz Franco,II,VI Anselmo J. Otero GonzálezI

I Centro de Estudios de Proteínas. Facultad de Biología. Universidad de La Habana. La Habana, Cuba.
II Centro de Análisis Proteómico y Bioquímico. Universidad Católica de Brasilia. Brasilia DF, Brasil.
III Subdirección de Parasitología. Instituto de Medicina Tropical "Pedro Kourí". La Habana, Cuba.
IV 3P Biopharmaceuticals. Pamplona, Navarra, España.
V Subdirección de Microbiología. Departamento de Bacteriología-Micología. Instituto de Medicina Tropical "Pedro Kourí". La Habana, Cuba.
VI Universidad Católica Dom Bosco. Campo Grande, Mato Grosso do Sul, Brasil.

 

 


RESUMEN

Introducción: la terapia de las enfermedades infecciosas se ha dificultado por la aparición de patógenos emergentes y reemergentes que muchas veces son resistentes a los antibióticos convencionales, por ello se ha incrementado la búsqueda de nuevos agentes terapéuticos. En este sentido los péptidos antimicrobianos constituyen una opción promisoria, ya que presentan un amplio espectro de actividad frente a varios microorganismos patógenos. Uno de los péptidos que ha sido informado es Cm-p5, el cual fue caracterizado estructural y funcionalmente mostrando actividad contra hongos patógenos en humanos, especialmente Candida albicans.
Objetivo: caracterizar de forma complementaria al péptido antifúngico Cm-p5 con respecto a su actividad hemolítica, citotoxicidad y su carácter fungicida o fungistático.
Métodos: se realizó un ensayo de actividad hemolítica y otro de citotoxicidad frente a la línea celular RAW 264.7, un experimento para evaluar su efecto antifúngico frente a C. albicans; se comparó su actividad antifúngica con la del péptido LL-37 y se alineó su secuencia con las de otros péptidos antimicrobianos.
Resultados: se comprobó que Cm-p5 no presenta hemólisis significativa a las concentraciones cercanas a su concentración mínima inhibitoria, y que no es citotóxico a las concentraciones evaluadas. También se demostró que tiene efecto fungistático sobre el crecimiento de C. albicans a las concentraciones entre 10-40 µg/mL, y que su actividad antifúngica es menos potente que la del péptido LL-37. Además, se demostró que posee regiones conservadas con respecto a otros péptidos antimicrobianos.
Conclusiones: con esta investigación se complementa la caracterización de Cm-p5 como un candidato promisorio para el tratamiento de las micosis en humanos, especialmente las candidiasis.

Palabras clave: péptidos antimicrobianos; Cm-p5; antifúngico; actividad hemolítica; citotoxicidad; tiempo de muerte; alineamiento múltiple de secuencias.


ABSTRACT

Introduction: therapy for infectious disease has been hampered by the appearance of emerging and re-emerging pathogens which are often resistant to conventional antibiotics. This has led to an increase in the search for new therapeutic agents. Antimicrobial peptides are a promising alternative in this respect, due to their broad spectrum of activity against several pathogenic microorganisms. One of the peptides reported is Cm-p5, which has been characterized structurally and functionally as displaying activity against pathogenic fungi in humans, particularly against Candida albicans.
Objective: present a complementary characterization of the antifungal peptide Cm-p5 in terms of its hemolytic activity, cytotoxicity, and fungicidal or fungistatic action.
Methods: an assay was conducted for hemolytic activity of peptide Cm-p5 and another for cytotoxicity against cell line RAW 264.7. Additionally, an experiment was performed to evaluate its antifungal effect against C. albicans, comparing its antifungal activity with that of peptide LL-37, and aligning its sequence with those of other antimicrobial peptides.
Results: it was found that Cm-p5 does not display significant hemolysis at concentrations close to its minimum inhibitory concentration, and that it is not cytotoxic at the concentrations evaluated. Peptide Cm-p5 was also found to have a fungistatic effect on the growth of C. albicans at concentrations of 10-40 µg/mL, its antifungal activity being less potent than that of peptide LL-37. Additionally, it was shown to have conserved regions with respect to other antimicrobial peptides.
Conclusions: the study complements the characterization of Cm-p5 as a promising candidate for the treatment of human mycoses, particularly candidiasis.

Keywords: antimicrobial peptides; Cm-p5; antifungal; hemolytic activity; cytotoxicity; kill time; multiple sequence alignment.


 

 

INTRODUCCIÓN

En los últimos años los péptidos antimicrobianos (PAMs) han recibido mucha atención debido a sus potencialidades terapéuticas. Se ha mencionado que pudieran ser empleados para el tratamiento de las enfermedades infecciosas y/o complementar la terapia con los antibióticos convencionales.1 Muestran un amplio espectro de acción frente a microorganismos como hongos, bacterias, virus y parásitos2 tanto directa como indirectamente.3 Además, se encuentran ampliamente distribuidos en la naturaleza, desde organismos unicelulares hasta mamíferos.2

Estas moléculas han sido aisladas de diversas fuentes entre las cuales se destacan los invertebrados marinos, en particular, los de plataforma insular. Estos animales están expuestos a microorganismos patógenos de humanos a partir de desechos domésticos e industriales en zonas antropizadas. También hay que considerar que estos organismos carecen de inmunidad adquirida y sus armas de defensa moleculares se basan principalmente en sus PAMs.2

En 2010 se aisló por López-Abarrategui y otros a partir del caracol costero Cenchritis muricatus (Gastropoda: Littorinidae, Linnaeus, 1758) un péptido catiónico de 10 aminoácidos (SRSELIVHQR), denominado Cm-p1. Este péptido resultó tener actividad frente a levaduras y hongos filamentosos sin mostrar toxicidad en células de mamíferos.4 Sin embargo, con el objetivo de mejorar su actividad antifúngica a partir de él se sintetizó un derivado nombrado Cm-p5 (SRSELIVHQRLF).

Cm-p5 se diseñó mediante estudios bioinformáticos, y se obtuvo por la adición de dos residuos aminoacídicos (LF) al extremo C-terminal de Cm-p1. Se caracteriza por presentar el extremo N libre y cargado positivamente. Según estudios conformacionales de espectroscopía de resonancia magnética nuclear, modelación molecular y polarimetría de dicroísmo circular adopta una estructura α-helicoidal anfipática alterna. Su concentración mínima inhibitoria (CMI), determinada mediante el método de microdilución descrito por el Comité Internacional de Estándares Clínicos y de Laboratorio5 frente a C. albicans es de 10 µg/mL y su concentración media efectiva (CI50) de 1,146 µg/mL.6

A pesar de que se ha avanzado en la caracterización estructural y funcional del péptido Cm-p5, aún se desconocen importantes propiedades de este que pudieran ofrecer información determinante para su futuro empleo terapéutico. Es por ello que el objetivo del presente trabajo es caracterizar de forma complementaria al péptido antifúngico Cm-p5 con respecto a su actividad hemolítica, citotoxicidad y su carácter fungicida o fungistático, así como mediante la comparación de su actividad antifúngica con la del PAM humano LL-37 y la predicción de regiones y secuencias conservadas mediante alineamiento múltiple de secuencias (AMS).

 

MÉTODOS


CEPAS ESTUDIADAS Y CONDICIONES DE CULTIVO

Se estudiaron dos cepas de C. albicans (ATCC 10231 y 01U). La cepa 01U es resistente a fluconazol y procede de un aislamiento clínico. Ambas cepas fueron obtenidas de la Unidad de Postgrado e Investigaciones de la Universidad Católica de Brasilia, Brasil. Las cepas se encontraban conservadas en agua destilada estéril a temperatura ambiente. Para su posterior empleo fueron cultivadas en medio agar Sabouraud-dextrosa y se incubaron por 72 h a 28 °C.


ENSAYO HEMOLÍTICO

La actividad hemolítica de Cm-p5 se evaluó determinando la liberación de hemoglobina de una suspensión de eritrocitos humanos y de conejo, ambas al 8 %, mediante lectura espectrofotométrica a una longitud de onda (λ) de 414 nm7 en un espectrofotómetro (UV Shimadzu modelo 1800, Japón). Los eritrocitos fueron colectados a partir de sangre fresca de humanos y de conejos, respectivamente.

Se evaluaron varias concentraciones del péptido (10, 20, 40 y 80 µg/mL). Las muestras fueron incubadas por 1 h a 37 °C. Posteriormente, fueron centrifugadas a 10 000 g durante 5 min y se realizó la lectura del sobrenadante a 414 nm. El tampón fosfato salino (TFS) fue usado como control negativo (0 % de hemólisis), y el tritón X-100 al 1 % como control positivo (100 % de hemólisis). Todos los ensayos fueron realizados por triplicado. El péptido Cm-p1 fue evaluado previamente4 para su actividad hemolítica siguiendo la metodología aquí descrita. Estos datos fueron utilizados en este trabajo para una comparación con Cm-p5.

El porcentaje de hemólisis fue calculado con la siguiente ecuación:

Hemólisis (%) = [(Abs 414 nm del péptido en solución - Abs 414 nm de TFS)] x 100

donde: Abs es la absorbancia medida.

Para realizar el análisis estadístico de los datos, los porcentajes de hemólisis fueron transformados con la función: "arco seno (raíz cuadrada (p/100))" donde "p" es el porcentaje de hemólisis. Se comprobó el ajuste de los datos a la normalidad por el ensayo de Kolmogorov-Smirnov y la homogeneidad de varianzas por el ensayo de Bartlett. Después se realizó un análisis de varianza (ANOVA) de clasificación simple, y para la comparación a posteriori de las medias contra un control se utilizó el ensayo de Dunnett, mientras que para la comparación de los péptidos se realizó una prueba t de Student.


ESTUDIO DE CITOTOXICIDAD

La citotoxicidad de Cm-p5 fue evaluada mediante el método del bromuro de (3-(4,5-dimetiltiazol-2-il)-2,5-difeniltetrazolio) (MTT) (Sigma-Aldrich, St. Louis, MO, USA) en placas de 96 pocillos (Thermo Scientific, Nunclon Delta Surface, Nunc, Dinamarca) descrito anteriormente.8 Se utilizó la línea celular de macrófagos de ratón RAW 264.7 obtenidas del banco de células de la Universidad Federal de Río de Janeiro, Brasil. Se empleó el medio esencial mínimo de Eagle modificado por Dulbecco (4 mmol/L de glutamina, 10 % suero fetal bovino, 10 000 unidades/mL de penicilina y 100 µg/mL de estreptomicina). Todos los componentes del medio fueron obtenidos de Sigma-Aldrich, St. Louis, MO, USA. Se empleó un volumen final de cultivo de 100 µL.

Se inocularon 1 x 105 células por pozo y se incubaron durante toda la noche con dos concentraciones diferentes del péptido (100 y 200 µg/mL). Luego de la incubación se adicionaron en cada pozo 10 µL de la solución de MTT (5 mg/mL en TFS). Las placas fueron incubadas por 4 h a 5 % de CO2 a 37 °C. Posteriormente, se descartó el medio y se adicionó dimetilsulfóxido (DMSO) (Mallinckrodt Chemical, USA) al 100 % en cada pozo para inhibir la generación del formazán. La Abs fue medida a 575 nm en un lector de placas de ELISA (BioTek, USA). El TFS fue empleado como control negativo de citotoxicidad y el tritón X-100 como control positivo a iguales concentraciones que los péptidos. Cada concentración fue evaluada por triplicado.

El procesamiento de los resultados se realizó mediante un ANOVA de clasificación simple, y para la comparación a posteriori de medias se utilizó el ensayo de Tukey. Este análisis se llevó a cabo después de comprobar el ajuste de los datos a la normalidad por el ensayo de Kolmogorov-Smirnov y la homogeneidad de varianzas por el ensayo de Bartlett.


EXPERIMENTOS DE MUERTE CELULAR DE C. albicans A LAS 24 h DE CULTIVO

En estos experimentos se empleó la cepa C. albicans ATCC 10231, la cual se cultivó en placas con agar papa-dextrosa para la selección de colonias después de un período de incubación de 48 h. Estas colonias se suspendieron en agua destilada estéril, y posteriormente esta solución fue ajustada mediante la cámara de Neubauer (aproximadamente 5 x 106 células/mL). Finalmente, la suspensión celular se diluyó 1:10, lo que corresponde a un inóculo inicial aproximado de 1 x 105 células/mL.9

El medio de cultivo empleado fue el RPMI-1640 sin bicarbonato de sodio (Gibco BRL, USA). Se usó como control de actividad fungicida la anfotericina B (ANB) (Sigma-Aldrich, Cat. No.A-4888) a la concentración de 10 µg/mL. Las concentraciones de Cm-p5 evaluadas fueron 5, 10, 20 y 40 µg/mL.

En los puntos de tiempo predeterminados (0, 12 y 24 h) se tomaron alícuotas de cada solución analizada y se realizaron diluciones decimales. Posteriormente se inocularon en placas Petri con agar papa-dextrosa y se incubaron durante 48 h a 37 °C para realizar el conteo de colonias. Cada concentración fue evaluada por duplicado.

Se comprobó la normalidad de los datos por el ensayo de Kolmogorov-Smirnov y la homogeneidad de varianzas por el ensayo de Bartlett. Se graficaron los log10 de las unidades formadoras de colonias (UFC)/mL a las 0 ,12 y 24 h para cada una de las concentraciones evaluadas y se les realizó una regresión lineal. Finalmente, se estimaron las diferencias entre las pendientes por un análisis de covarianza.


EVALUACIÓN DE LA ACTIVIDAD ANTIFÚNGICA DE Cm-p5 CON RESPECTO AL PÉPTIDO LL-37

La evaluación de la actividad de los péptidos antimicrobianos Cm-p5 y LL-37 ([LL-37, 37 aa])10 se realizó en placas de 96 pocillos empleando el medio RPMI-1640 sin bicarbonato de sodio (Gibco BRL, USA). Como control de actividad fungicida se utilizó la ANB a la concentración de 10 µg/mL. Las concentraciones de Cm-p5 y LL-37 evaluadas fueron 10 µg/mL y 5 µg/mL, respectivamente.

La cepa utilizada fue C. albicans 01U, la cual fue cultivada en agar papa-dextrosa durante 48 h a 37 °C. Posteriormente, se seleccionaron las colonias adecuadas para preparar el inóculo, el cual fue de 1 x 105 células/mL. Luego, se incubó con los péptidos a evaluar y cada 6 h se tomaron alícuotas. Se midió la Abs a 620 nm en un lector de placas de ELISA (BioTek, USA). Cada péptido fue evaluado por duplicado.

Se comprobó la normalidad de los datos por el ensayo de Kolmogorov-Smirnov y la homogeneidad de varianzas por el ensayo de Bartlett. Se graficaron las medias de dos réplicas a 0, 6,12, 18 y 24 h. A cada curva se le hizo una regresión lineal. Finalmente, se estimaron las diferencias entre los grupos con un ensayo de Tukey.


PREDICCIÓN DE REGIONES Y RESIDUOS CONSERVADOS EN Cm-p5 MEDIANTE AMS

La secuencia de aminoácidos de Cm-p5 se comparó con las secuencias aminoacídicas anotadas en la base de datos de otros péptidos antimicrobianos.11 Las secuencias identificadas se utilizaron para construir un AMS, mediante el programa CLUSTALW.12 Con el objetivo de identificar las posiciones con menor variabilidad se estimó a partir del AMS obtenido, la variabilidad posicional mediante el método de la entropía posicional13 implementado en el software BioEdit.14 Mediante este método se obtiene una medida cuantitativa de la incertidumbre en cierta posición con respecto a otras. Para el cálculo de la entropía por posición, el AMS es tratado como una matriz de caracteres. En BioEdit, la entropía se estima a partir de la siguiente ecuación:

donde: es la frecuencia con la que el carácter b aparece en la columna l, siendo mínima (0 nits) cuando no hay variación en la posición (aminoácido totalmente conservado) y máxima (3.04 nits) cuando la variabilidad es máxima (todos los aminoácidos están igualmente representados).

El grado de conservación de cada residuo aminoacídico de Cm-p5 se calculó mediante el algoritmo de Bayes15 implementado en el servidor web Consurf.16 Mediante este método es posible identificar aminoácidos variables (valor 0 en la escala discreta de conservación) y aminoácidos conservados (valor 9 en la escala discreta de conservación). La proyección del grado de conservación de cada residuo sobre la estructura 3D de Cm-p5 se realizó con el visualizador PyMol.17

 

RESULTADOS


ACTIVIDAD HEMOLÍTICA

Tanto el péptido Cm-p5 como Cm-p1, presentaron una baja actividad hemolítica a las concentraciones cercanas a su CMI informada (tabla 1 y 2). Además, se observó un incremento en la actividad hemolítica de los péptidos al aumentar la concentración de estos sin llegar a superar el 15 % de hemólisis tanto frente a eritrocitos humanos como de conejos.


CITOTOXICIDAD DE Cm-p5

El péptido Cm-p5 no mostró citotoxicidad en un cultivo in vitro de la línea celular de macrófagos de ratones RAW 264.7. La viabilidad y proliferación celular no evidenciaron afectaciones morfológicas ni de crecimiento en presencia del péptido con respecto al cultivo control de esta línea celular (Fig. 1).


EXPERIMENTOS DE MUERTE CELULAR DE C. albicans A LAS 24 h DE CULTIVO

El péptido antifúngico Cm-p5 presentó efecto inhibitorio sobre el crecimiento de la cepa de C. albicans ATCC 10231 en el rango entre 10 µg/mL y 40 µg/mL, observándose un efecto fungistático independiente de la concentración peptídica (disminución de las UFC/mL < 99,9 % con respecto al inóculo inicial) (Fig. 2) que inhibe el crecimiento de la levadura y no provoca el efecto de tiempo de muerte característico de los compuestos fungicidas, como se manifiesta en el caso de la ANB (disminución de las UFC/mL > 99,9 % con respecto al inóculo inicial).



COMPARACIÓN DE LA ACTIVIDAD ANTIFÚNGICA DE Cm-p5 CON LA DEL LL-37

El péptido Cm-p5 y el LL-37 presentaron actividad antifúngica contra la cepa C. albicans 01U (Fig. 3); sin embargo, la defensina tuvo un efecto más marcado.



PREDICCIÓN DE REGIONES Y RESIDUOS CONSERVADOS EN Cm-p5 MEDIANTE AMS

La comparación de la secuencia aminoacídica de Cm-p5 con las secuencias aminoacídicas anotadas en la base de datos AMP indicó valores de identidad en secuencia (% id) entre 13 % y 29 % con diferentes péptidos antimicrobianos (Fig. 4).

Estas secuencias aminoacídicas pertenecen a organismos de los Phyla Firmicutes, Annelida, Chordata y Arthropoda. Los mayores % id fueron con los péptidos Urechistachykinina I (25 %) y con miembros de la familia de las Hyposinas (Hyposina-5, 29 % e Hyposina-4, 25 %). Este resultado está en concordancia con lo observado para el parental Cm-p1. 4 Por otra parte, los valores de similitud en secuencia (% sim) se encuentran entre 17 % y 43 %.

El análisis del AMS mediante el método de la entropía posicional (Fig. 4), permitió identificar regiones con diferentes grados de conservación en los PAMs. Las posiciones 6 y 7 (posiciones 11 y 12 del alineamiento) son las que presentan menor variabilidad (valor de incertidumbre: 0,68 y 0,85, respectivamente) mientras que la mayor variabilidad (valor de incertidumbre: 2,04) se obtuvo para la posición 5 (posición 10 del alineamiento).

El análisis del grado de conservación de cada residuo aminoacídico de Cm-p5, muestra a los residuos Ile6 y Val7 como los más conservados (9 en la escala discreta de conservación). Resulta notable la conservación de los residuos básicos que flanquean la hélice Arg2 y Arg 10 (8 y 7 en la escala discreta de conservación respectivamente) (Fig. 5).


 

DISCUSIÓN

Para que un péptido sea de interés farmacéutico debe combinar una alta actividad antimicrobiana con una baja toxicidad frente a las células normales del hospedero, siendo esta una de las principales desventajas del empleo terapéutico de los PAMs. Por lo tanto, la búsqueda de nuevos compuestos que no sean tóxicos es una de las prioridades en el desarrollo de nuevas terapias antifúngicas.18

Teniendo en cuenta que el péptido Cm-p1 es el antecesor directo del péptido Cm-p5, resultó conveniente establecer una comparación entre las actividades hemolíticas de ambas moléculas. En este estudio se demostró que ambos péptidos tienen una actividad hemolítica similar, pues no se encontraron diferencias significativas entre sus actividades mediante el análisis estadístico. Por su parte, Cm-p5 tuvo una actividad hemolítica inferior al 10 % para una concentración efectiva dos veces superior a su CMI, lo cual documenta su posible valor terapéutico.

La citotoxicidad de Cm-p5 fue evaluada con anterioridad por López-Abarrategui y otros, sin embargo, los datos no fueron mostrados. Es por ello que en este estudio se incluyen estos resultados. Cm-p5 no mostró citotoxicidad a las concentraciones evaluadas frente a la línea celular de ratón RAW 264.7, lo cual coincide con la citotoxicidad de Cm-p1 previamente evaluada frente a la misma línea celular.4 Esta es una línea celular con características de monocito-macrófago de ratón transformado por el virus de la leucemia de Abelson, y tiene una estrecha relación funcional con la respuesta inmune celular antimicrobiana. Su crecimiento es inhibido por el lipopolisacárido soluble (LPS), y por esa razón es frecuentemente utilizada para evaluar toxicidad de agentes antimicrobianos. Este es el caso del péptido Cm-p5 que mostró una baja toxicidad ante estas células a concentraciones 10 veces mayores a su CMI (100 μg/mL), lo cual fue confirmado mediante el análisis estadístico realizado no encontrándose diferencias significativas entre el control negativo y Cm-p5 a 100 μg/mL.

Teniendo en cuenta que Cm-p5 tiene una baja hidrofobicidad,6 es de esperar este efecto pues como había planteado previamente Chen y otros existe una estrecha correlación entre la hidrofobicidad de los PAMs y su actividad hemolítica.19 De igual manera estos autores establecieron una relación entre bajos niveles de hidrofobicidad de los PAMs y una baja toxicidad frente a células de mamíferos y una alta selectividad.20

Estas propiedades sugieren que Cm-p5 es un péptido con alto potencial terapéutico para el tratamiento de las candidiasis, lo que podrá ser aprovechado para posibles formulaciones terapéuticas en combinación con otros agentes antifúngicos.

La cepa de C. albicans ATCC 10231 es ampliamente recomendada para la comparación de agentes fungicidas con la clásica ANB, por lo que se empleó en este estudio para establecer una comparación entre Cm-p5 y la ANB. Cm-p5 mostró un comportamiento fungistático en el intervalo entre 10 µg/mL y 40 µg/mL (Fig. 1). Esto demuestra que la actividad de Cm-p5 contra C. albicans es independiente de la concentración del péptido en solución. Este es un efecto similar al observado para el antifúngico convencional fluconazol9 y diferente del de la anfotericina B que exhibe un carácter fungicida eliminando permanentemente la población microbiana en 24 h.

Resulta de interés resaltar que el fluconazol es un compuesto fungistático con una CMI entre 16-128 µg/mL frente a aislados clínicos de C. incospicua.9 Estos valores de CMIs son mayores, incluso de un orden superior, que los del péptido antifúngico Cm-p5. Esta característica, unida a otras como la baja toxicidad frente a células de mamíferos, avala la efectividad de esta molécula como un posible candidato terapéutico.

Este comportamiento en los antifúngicos convencionales se ha tenido en cuenta para la combinación de efectos fungicidas y fungistáticos, cuando la droga principal elimina la población activa de microorganismos y tiene un efecto tóxico significativo como en el caso de la ANB. Además, si en esta combinación uno de los componentes es un péptido antifúngico como Cm-p5, habría que tener en cuenta los posibles beneficios inmunomoduladores adicionales a la actividad antifúngica, lo cual pudiera ser optimizado mediante el diseño de análogos químicos o secuenciales. También esta combinación pudiera permitir el empleo de una concentración menor de la droga fungicida, atenuando así su manifiesta toxicidad en dosis terapéuticas.2

La defensina humana LL-37 es uno de los péptidos antimicrobianos más estudiado debido a sus múltiples actividades, pues no solo actúa como antimicrobiano sino que también puede modular la respuesta inmune en el cuerpo.21 Es por ello que se comparó la actividad antifúngica de Cm-p5 con la de este péptido. La cepa empleada fue C. albicans 01U, la cual es resistente a fluconazol y sensible al LL-37. Además, en estudios realizados por López-Abarrategui el péptido antifúngico Cm-p5 mostró una CMI frente a esta cepa de 10 µg/mL,4 por lo cual resulta particularmente atractiva para una comparación entre ambos péptidos.

El LL-37 mostró una potente actividad frente a C. albicans 01U, lo cual se comprobó mediante el análisis estadístico al determinarse que no existen diferencias significativas entre el LL-37 y la ANB, mientras que entre el LL-37 y Cm-p5 se comprobó un nivel de significación menor que 0,01. La actividad de este péptido fue considerablemente mayor que la de Cm-p5, lo cual pudiera deberse a las diferencias estructurales entre estos dos péptidos así como a otras propiedades como la hidrofobicidad y la carga neta que son determinantes en la actividad antimicrobiana de los PAMs.

El LL-37 es un péptido de 37 aminoácidos que adopta una estructura en α-hélice anfipática21 al igual que Cm-p5, aunque este último solo cuenta con 12 residuos aminoacídicos4. Además, la estructura secundaria del LL-37 puede dividirse en tres porciones con características específicas. La primera de ellas es la región hidrofóbica hacia el extremo N-terminal (1-11 aa), la parte central (12-29 aa) α-hélice y una pequeña porción hidrofílica en el extremo C-terminal (30-37 aa).21 Sin embargo, Cm-p5 muestra residuos hidrofóbicos hacia el extremo C-terminal mientras que el N-terminal está libre y cargado positivamente.4

Otra característica determinante de la actividad antifúngica de los PAMs es su carga neta positiva.22 En este aspecto también existen diferencias entre el LL-37 y Cm-p5, pues el primero tiene una carga de 6+ mientras que el segundo de 2+.

En cuanto al AMS, el péptido Cm-p5 presentó resultados similares a los obtenidos para su parental Cm-p1.4 El mayor valor de identidad en secuencia se obtuvo con la Hyposina-5 (29 %), un péptido antimicrobiano identificado en las secreciones de la piel de la rana Phyllomedusa hypochondrialis azurea.23 Este porcentaje fue menor que el observado para Cm-p1 (40 %). Porcentajes similares a los obtenidos con Cm-p1, fueron observados para otro miembro de la familia de las Hyposinas, Hyposina-4 (25 %), y para Urechistachykinina I (25 %), un neuropéptido derivado del invertebrado Urechis unicinctus. Resulta notable el porcentaje de similitud en secuencia con el péptido VESP-VB1 (43 %), un péptido antimicrobiano aislado del veneno de la avispa Vespa bicolor Fabricius,24 teniendo en cuenta el bajo porcentaje de identidad en secuencia (14 %). Este constituye el mayor porcentaje de similitud en secuencia observado.

De acuerdo con el método de la entropía posicional, las posiciones con menor variabilidad se sitúan hacia el centro de la molécula. Según estudios previos, esta región hidrofóbica pudiera ser esencial en la actividad antifúngica de estos péptidos.25 Esta región, de conjunto con los extremos, se ha propuesto como determinante para la interacción péptido-membrana4. En ese sentido, los aminoácidos básicos en los extremos (Arg2 y Arg10 en Cm-p5) al tener carga positiva, pudieran favorecer la interacción péptido-membrana. Por otra parte, el residuo Val7, altamente conservado en este tipo de péptidos, parece ser esencial para la interacción con hongos.26

 

CONSIDERACIONES GENERALES

Estos resultados avalan al péptido Cm-p5 como un candidato terapéutico promisorio para el tratamiento de la candidiasis en humanos, pues no presenta altos valores de actividad hemolítica y no es citotóxico. Sin embargo, aún es necesario continuar con el estudio de este péptido antifúngico. Por otra parte, la presencia de residuos aminoacídicos altamente conservados en su estructura puede permitir la síntesis de nuevos derivados que potencien su actividad antifúngica.

 

Conflictos de intereses

Los autores no declaran conflictos de intereses.

 

REFERENCIAS BIBLIOGRÁFICAS

1. Yan H, Hancock RE. Synergistic interactions between mammalian antimicrobial defense peptides. Antimicrob. Agents Chemother. 2001;45(5):1558-60.

2. Otero-González AJ, Magalhaes BS, Garcia-Villarino M, López-Abarrategui C, Sousa DA, Dias SC, et al. Antimicrobial peptides from marine invertebrates as a new frontier for microbial infection control. FASEB J. 2010;24(5):1320-34.

3. Steinstraesser L, Kraneburg U, Jacobsen F, Al-Benna S. Host defense peptides and their antimicrobial-immunomodulatory duality. Immunobiology. 2011;216(3):322-33.

4. López-Abarrategui C, Alba A, Silva ON, Reyes-Acosta O, Vasconcelos IM, Oliveira JT, Migliolo L, et al. Functional characterization of a synthetic hydrophilic antifungal peptide derived from the marine snail Cenchritis muricatus. Biochimie. 2012;94(4):968-74.

5. CLSI. Reference method for broth dilution antifungal susceptibility testing of yeasts. Approved Standard-Eighth Edition. Wayne, PA: Clinical and Laboratory Standards Institute; 2008.

6. López-Abarrategui C, McBeth C, Mandal SM, Sun ZJ, Heffron G, Alba-Menendez A, et al. Cm-p5: an antifungal hydrophilic peptide derived from the coastal mollusk Cenchritis muricatus (Gastropoda: Littorinidae). FASEB J. 2015;29:3315-25.

7. Zhao J, Zhao C, Liang G, Zhang M, Zheng J. Engineering antimicrobial peptides with improved antimicrobial and hemolytic activities . Journal of Chemical Information and Modeling. 2013;53(12):3280-96.

8. Pasupuleti M, Schmidtchen A, Chalupka A, Ringstad L, Malmsten M. End-tagging of ultra-short antimicrobial peptides by W/F stretches to facilitate bacterial killing. PLoS ONE. 2009;4:e5285.

9. Szabo Z, Soczo G, Miszti C, Hermann P, Rozgonyi F. In vitro activity of fluconazole and amphotericin B against Candida inconspicua clinical isolates as determined by the time-kill method. Acta Microbiol Immunol Hung. 2008;55(1):53-61.

10. Frohm M, Agerberth B, Ahangari G, Stahle-Backdahl M, Liden S, Wigzell H, et al. The expression of the gene coding for the antibacterial peptide LL-37 is induced in human keratinocytes during inflammatory disorders. J Biol Chem. 1997;272(24):15258-63.

11. Wang G, Li X, Wang Z. APD2: the updated antimicrobial peptide database and its application in peptide design. Nucleic Acids Res. 2009;37:D933-D7.

12. Thompson JD, Higgins DG, Gibson TJ. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 1994;22:4673-80.

13. Shannon CE. The mathematical theory of communication. Illinois: University of Illinois Press; 1949.

14. Hall TA. BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Ser. 1999;41:95-8.

15. Susko E, Inagaki Y, Field C, Holder ME, Roger AJ. Testing for differences in rates-across-sites distributions in phylogenetic subtrees. Mol Biol Evol. 2002;19:1514-23.

16. Glaser F, Pupko T, Paz I, Bell RE, Bechor-Shental D, Martz E, et al. ConSurf: Identification of Functional Regions in Proteins by Surface-Mapping of Phylogenetic Information. Bioinformatics. 2003;19:163-4.

17. DeLano WL. The PyMOL Molecular Graphics System. User Manual. 2002 [cited 2016 Nov 6]. . Disponible en: http://www.pymol.org

18. Kim H, Jang JH, Kim SC, Cho JH. De novo generation of short antimicrobial peptides with enhanced stability and cell specificity. J Antimicrob Chemother. 2014;69(1):121-32.

19. Chen Y, Mant CT, Farmer SW. Rational design of alpha-helical antimicrobial peptides with enhanced activities and specificity/therapeutic index. J Biol Chem. 2005;280:12316-29.

20. Chen Y, Guarnieri MT, Vasil AI, Mant CT, Hodges RS. Role of peptide hydrophobicity in the mechanism of action of alpha-helical antimicrobial peptides. Antimicrob. Agents Chemother. 2007;51:1398e-1406.

21. Burton MF, Steel PG. The chemistry and biology of LL-37. Nat Prod Rep. 2009;26:1572-84.

22. Su Y, Li S, Hong M. Cationic membrane peptides: atomic-level insight of structure-activity relationships from solid state NMR. Amino Acids. 2013;44:821-33.

23. Thompson AH, Bjourson AJ, Orr DF, Shaw C, McClean S. Amphibian skin secretomics: application of parallel quadrupole time-of-flight mass spectrometry and peptide precursor cDNA cloning to rapidly characterize the skin secretory peptidome of Phyllomedusa hypochondrialis azurea: discovery of a novel peptide family, the hyposins. J Proteome Res. 2007;6:3604-13.

24. Chen W, Yang X, Zhai L, Lu Z, Liu J, Yu H. Antimicrobial peptides from the venoms of Vespa bicolor Fabricius. Peptides. 2008;29:1887-92.

25. Lee J, Lee DG. Influence of the hydrophobic amino acids in the N- and C-terminal regions of pleurocidin on antifungal activity. J Microbiol Biotechnol. 2010;20:1192e-5.

26. Cao W, Zhou Y, Ma Y, Luo Q, Wei D. Expression and purification of antimicrobial peptide adenoregulin with C-amidated terminus in Escherichia coli. Protein Expr Purif. 2005;40:404e-410.

 

 

Recibido: 28 de febrero de 2017.
Aceptado: 10 de abril de 2017.

 

 

Anselmo J. Otero González . Centro de Estudios de Proteínas. Facultad de Biología. Universidad de La Habana. La Habana, Cuba. Correo electronico: rcmtropical@infomed.sld.cu

Creative Commons License All the contents of this journal, except where otherwise noted, is licensed under a Creative Commons Attribution License